If you have been reading about HPLC-UV and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-06-25. Numbers and descriptions here follow the published literature rather than marketing material.
Regulatory treatment of creatine monohydrate varies by country and intended use. In some jurisdictions it is sold as a dietary supplement, while in others it may be treated as a food ingredient or a pharmaceutical raw material. Pharmacopeial monographs, where available, define identification, assay limits, and impurity thresholds. Manufacturers often follow these monographs or internal specifications to ensure batch-to-batch consistency. Analytical method validation is important because different methods can yield different apparent purity values if sample preparation or detection conditions are not controlled.
Quality control for creatine monohydrate begins with identity confirmation and assay determination. Laboratories commonly use high-performance liquid chromatography with ultraviolet detection, often after derivatization or using a suitable column, to quantify creatine. Karl Fischer titration measures water content, which helps verify the monohydrate stoichiometry. Additional tests screen for heavy metals, residual solvents, and microbial contamination depending on the intended use. These tests establish composition and purity rather than biological effect.
In the human body, creatine is synthesized mainly in the liver and kidneys from the amino acids glycine, arginine, and methionine. Dietary sources include meat, fish, and other animal tissues, which supply preformed creatine. Because plant foods contain little or no creatine, dietary intake varies widely among populations. The compound is stored largely in skeletal muscle, where it is converted to phosphocreatine and used to regenerate adenosine triphosphate during short bursts of activity.
Creatine monohydrate is one of several solid forms of creatine described in the literature. Other forms include anhydrous creatine, creatine hydrochloride, and creatine ethyl ester, each with different solubility and stability characteristics. The monohydrate is distinct from creatinine, a spontaneous breakdown compound that forms when creatine loses water and cyclizes. Commercial descriptions sometimes use synonyms such as methylguanidoacetic acid or N-(aminoiminomethyl)-N-methylglycine, which refer to the same base molecule. These names appear in chemical databases and product labels.
| Property | Value | Notes |
|---|---|---|
| Common synonyms | Creatine hydrate; N-carbamimidoyl-N-methylglycine monohydrate | Synonyms vary by naming convention |
| Typical assay method | HPLC-UV | Often paired with a reference standard |
| Water content method | Karl Fischer titration | Confirms monohydrate stoichiometry |
| Degradation product | Creatinine | Forms more readily in solution and with heat |
| Typical storage temperature | 15–25 °C | Keep dry and away from direct sunlight |
Regulatory status varies by country. In the United States, creatine monohydrate is sold as a dietary supplement ingredient, while in the European Union it is placed on the market as a food supplement component. Some jurisdictions have established purity monographs or permitted health claims, while others treat it as a novel food or require notification. Product labels may state the amount of creatine monohydrate or the equivalent creatine content, and the two figures can differ. Independent testing programs sometimes check identity, potency, and contaminant limits.
Creatine monohydrate is stable under dry, cool conditions but can degrade when exposed to moisture and heat. In solution, it undergoes hydrolysis to creatinine, a cyclic derivative with little role in phosphagen energy transfer. The rate of conversion increases with temperature, storage time, and acidic or alkaline pH. Solid material kept in a sealed container at room temperature generally retains its composition for extended periods. Moisture uptake is a primary concern because it can accelerate breakdown and caking.
Creatine was first identified in skeletal muscle extracts in the nineteenth century, and its role in phosphagen energy buffering was clarified in the twentieth century. The monohydrate salt became widely studied after methods for inexpensive synthesis and crystallization were developed. Modern research examines its effects on muscle energetics, recovery, and cognitive performance under specific conditions. Findings vary with population, exercise protocol, baseline creatine status, and measurement method. Studies often compare supplementation with placebo during controlled training or testing schedules.
Creatine monohydrate is a hydrated form of creatine, a nitrogen-containing compound involved in cellular energy metabolism. Its molecular formula is C4H9N3O2·H2O, with a molar mass around 149.15 g/mol. The monohydrate is the most common solid form used in research and commercial settings because it crystallizes readily and remains stable under ordinary conditions. The term monohydrate indicates one water molecule per creatine molecule in the crystal lattice. It appears as a white crystalline powder with low odor.
In the body, creatine is synthesized from the amino acids arginine, glycine, and methionine, primarily in the liver and kidneys. It is transported to muscle and other tissues, where it is phosphorylated to phosphocreatine by creatine kinase. This phosphagen system provides a rapid source of adenosine triphosphate during short, intense contractions. Dietary creatine comes mainly from meat and fish, and the body's total pool is influenced by both synthesis and intake.
As a supplement, creatine monohydrate is studied for its effects on muscle performance and recovery. The compound is often described as an ergogenic aid, meaning it may support physical work capacity. Research typically compares it with placebo or other forms, such as citrate or nitrate, under controlled conditions. Questions remain about the optimal dose and long-term effects in different populations, and findings are not uniform across all studies. The monohydrate form remains the most extensively tested.
Creatine monohydrate is a crystalline compound formed from creatine and one molecule of water. Its systematic name is N-(aminoiminomethyl)-N-methylglycine monohydrate, and it appears as a white, odorless powder with limited solubility in water. The monohydrate is the most common solid form used in research and commercial products because it is stable under dry conditions. The anhydrous form lacks the water of crystallization and differs slightly in molar mass. Both forms participate in the same biochemical reactions once dissolved.
Creatine monohydrate is the hydrated form of creatine, a nitrogen-containing organic acid involved in cellular energy transfer. Its molecular formula is C4H11N3O3, and it consists of creatine plus one water molecule in the crystal lattice. The anhydrous base, creatine, has the formula C4H9N3O2. The compound appears as a white, odorless, crystalline powder and is classified as a guanidine derivative. It is distinct from creatinine, a breakdown product measured in clinical chemistry.
In animals, creatine is synthesized mainly in liver, kidney, and pancreas from arginine, glycine, and methionine. The first committed step transfers a guanidino group from arginine to glycine, forming guanidinoacetate. Subsequent methylation by S-adenosylmethionine yields creatine. Dietary sources include meat and fish; endogenous synthesis supplies part of the body pool. Most creatine is stored in skeletal muscle, where it is converted to phosphocreatine and participates in rapid regeneration of adenosine triphosphate during short, intense activity.
Weak affinity chromatography (WAC) is an affinity chromatography technique for affinity screening in drug development. WAC is an affinity-based liquid chromatographic technique that separates chemical compounds based on their different weak affinities to an immobilized target. The higher affinity a compound has towards the target, the longer it remains in the separation unit, and this will be expressed as a longer retention time. The affinity measure and ranking of affinity can be achieved by processing the obtained retention times of analyzed compounds. Affinity chromatography is part of a larger suite of techniques used in chemoproteomics based drug target identification. The WAC technology is demonstrated against a number of different protein targets – proteases, kinases, chaperones and protein–protein interaction (PPI) targets. WAC has been shown to be more effective than established methods for fragment based screening. Affinity chromatography was conceived and first developed by Pedro Cuatrecasas and Meir Wilchek.
Analysis of molecular variance (AMOVA), is a statistical model for the molecular algorithm in a single species, typically biological. The name and model are inspired by ANOVA. The method was developed by Laurent Excoffier, Peter Smouse and Joseph Quattro at Rutgers University in 1992. Since developing AMOVA, Excoffier has written a program for running such analyses. This program, which runs on Windows, is called Arlequin and is freely available on Excoffier's website. There are also implementations in R language in the ade4 and the pegas packages, both available on CRAN (Comprehensive R Archive Network). Another implementation is in Info-Gen, which also runs on Windows. The student version is free and fully functional. Native language of the application is Spanish but an English version is also available. An additional free statistical package, GenAlEx, is geared toward teaching as well as research and allows for complex genetic analyses to be employed and compared within the commonly used Microsoft Excel interface. This software allows for calculation of analyses such as AMOVA, as well as comparisons with other types of closely related statistics including F-statistics and Shannon's index, and more.
Initial letters are used where there is no ambiguity: C cysteine, H histidine, I isoleucine, M methionine, S serine, V valine. No other amino acids in this set begin with each of those letters. Where arbitrary assignment is needed, the structurally simpler amino acids are given precedence: A alanine, G glycine, L leucine, P proline, T threonine. For example, alanine is simpler than arginine or asparagine, the other amino acids starting with "a". F PHenylalanine and R aRginine are assigned by being phonetically suggestive, W tryptophan is assigned based on the double ring being visually suggestive to the bulky letter W, K lysine and Y tyrosine are assigned as alphabetically nearest to their initials L and T (note that U was avoided for its similarity with V, while X was reserved for undetermined or atypical amino acids); for tyrosine the mnemonic tYrosine was also proposed, D aspartate was assigned arbitrarily, with the proposed mnemonic asparDic acid; E glutamate was assigned in alphabetical sequence being larger by merely one methylene –CH2– group, N asparagine was assigned arbitrarily, with the proposed mnemonic asparagiNe; Q glutamine was assigned in alphabetical sequence of those still available (note again that O was avoided due to similarity with D), with the proposed mnemonic Qlutamine.
Formation of the Quinonoid Intermediate PLP acts as an 'electron sink' absorbing delocalized electron density during the reaction intermediates (countering the excess electron density on the deprotonated a-carbon). PLP facilitates the enzyme activity, increasing the acidity of the alpha carbon by stabilizing the conjugate base. The PLP-stabilized carbanion intermediate formed is the quinonoid intermediate. Tyrosine and PLP stabilized 3C-Ring formation PLP and Tyrosine stabilize negative charges during deprotonation. Tyrosine attacks the sulfur bound carbon, allowing S(CH3)(Ado) to leave, and during ring formation, Tyrosine leaves. Note inhibitors AVG and AMA bind PLP to form a ketimine and oxime respectively (whose reverse reactions are much less favorable) and prevent the ACC synthase catalyzed reaction with SAM.
Sources: en.wikipedia.org
PABA and its salts are used in nutritional epidemiological studies to assess the completeness of 24-hour urine collection for the determination of urinary sodium, potassium, or nitrogen levels. The potassium salt (potassium paraaminobenzoate, "aminobenzoate potassium") is used as a drug against fibrotic skin disorders, such as Peyronie's disease, under the brand name Potaba. There is a lack of strong evidence. It is believed to work by inhibiting fibroblast glycosaminoglycan secretion and stabilizing monoamine oxidase A activity. PABA is also occasionally used in pill form by sufferers of irritable bowel syndrome to treat its associated gastrointestinal symptoms. PABA derivatives have also been proposed to function as acetylcholinesterase inhibitors in diseases that cause deficient cholinergic systems, such as Alzheimer's disease.
Membrane blebbing: The cell membrane shows irregular buds known as blebs. Initially these are smaller surface blebs. Later these can grow into larger so-called dynamic membrane blebs. An important regulator of apoptotic cell membrane blebbing is ROCK1 (rho associated coiled-coil-containing protein kinase 1). Formation of membrane protrusions: Some cell types, under specific conditions, may develop different types of long, thin extensions of the cell membrane called membrane protrusions. Three types have been described: microtubule spikes, apoptopodia (feet of death), and beaded apoptopodia (the latter having a beads-on-a-string appearance). Pannexin 1 is an important component of membrane channels involved in the formation of apoptopodia and beaded apoptopodia. Fragmentation: The cell breaks apart into multiple vesicles called apoptotic bodies, which undergo phagocytosis. The plasma membrane protrusions may help bring apoptotic bodies closer to phagocytes.
The mechanism of transport for importers supports the alternating-access model. The resting state of importers is inward-facing, where the nucleotide binding domain (NBD) dimer interface is held open by the TMDs and facing outward but occluded from the cytoplasm. Upon docking of the closed, substrate-loaded binding protein towards the periplasmic side of the transmembrane domains, ATP binds and the NBD dimer closes. This switches the resting state of transporter into an outward-facing conformation, in which the TMDs have reoriented to receive substrate from the binding protein. After hydrolysis of ATP, the NBD dimer opens and substrate is released into the cytoplasm. Release of ADP and Pi reverts the transporter into its resting state. The only inconsistency of this mechanism to the ATP-switch model is that the conformation in its resting, nucleotide-free state is different from the expected outward-facing conformation. Although that is the case, the key point is that the NBD does not dimerize unless ATP and binding protein is bound to the transporter.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
A disintegrin and metalloproteinase with thrombospondin motifs 7 (ADAMTS7) is an enzyme that in humans is encoded by the ADAMTS7 gene on chromosome 15. It is ubiquitously expressed in many tissues and cell types. This enzyme was historically reported to catalyze the degradation of cartilage oligomeric matrix protein (COMP), though subsequent studies using purified proteins and unbiased mass spectrometry found that ADAMTS7 does not cleave COMP. ADAMTS7 has been associated with cancer and arthritis in multiple tissue types. The ADAMTS7 gene is a well-established genetic susceptibility locus for coronary artery disease. The ADAMTS7 gene resides on chromosome 15 at the band 15q24.2 and contains 25 exons.
Sources: en.wikipedia.org
The first definition of the term bioinformatics was coined by Paulien Hogeweg and Ben Hesper in 1970, to refer to the study of information processes in biotic systems. This definition placed bioinformatics as a field parallel to biochemistry (the study of chemical processes in biological systems). Bioinformatics and computational biology involved the analysis of biological data, particularly DNA, RNA, and protein sequences. The field of bioinformatics experienced explosive growth starting in the mid-1990s, driven largely by the Human Genome Project and by rapid advances in DNA sequencing technology. Analyzing biological data to produce meaningful information involves writing and running software programs that use algorithms from graph theory, artificial intelligence, soft computing, data mining, image processing, and computer simulation. The algorithms in turn depend on theoretical foundations such as discrete mathematics, control theory, system theory, information theory, and statistics.
represents the turnover rate, or the number of reactions catalyzed by an enzyme over the enzyme amount. k c a t {\displaystyle k_{cat}} over k m {\displaystyle k_{m}} is known as the specificity constant, which gives a measure of the affinity of a substrate to some particular enzyme. Also known as the efficiency of an enzyme, this relationship reveals an enzyme's preference for a particular substrate. The higher the specificity constant of an enzyme corresponds to a high preference for that substrate.
The domain of automotive design has been traditionally characterized as male-dominated. As a result, there has been a lack of female automotive designers in the area of automotive safety compared to male automotive designers. This leads to oversights in automotive safety and ergonomics for female consumers, who make up 62% of all new cars sold in the USA. According to the Insurance Institute for Highway Safety (IIHS), women are less likely to get into a crash than men are. However, women are 17% more likely to die in a car crash and 73% more likely to sustain serious injuries from a crash when compared to men. In rear-end collisions, female drivers face a higher risk of whiplash injuries when compared to their male counterparts due to their lighter weight which causes them to be propelled forward more rapidly. To mitigate these problems, Consumer Reports states that regulators have called for a female crash dummy to be implemented in crash testing since 1980. When pregnant, women should continue to use seatbelts and airbags properly. A University of Michigan study found that "unrestrained or improperly restrained pregnant women are 5.7 times more likely to have an adverse fetal outcome than properly restrained pregnant women". If seatbelts are not long enough, extensions are available from the car manufacturer or an aftermarket supplier.
ATC code A10 Drugs used in diabetes is a therapeutic subgroup of the Anatomical Therapeutic Chemical Classification System, a system of alphanumeric codes developed by the World Health Organization (WHO) for the classification of drugs and other medical products. Subgroup A10 is part of the anatomical group A Alimentary tract and metabolism. Codes for veterinary use (ATCvet codes) can be created by placing the letter Q in front of the human ATC code: for example, QA10. National versions of the ATC classification may include additional codes not present in this list, which follows the WHO version. A10AB01 Insulin (human) A10AB02 Insulin (beef) A10AB03 Insulin (pork) A10AB04 Insulin lispro A10AB05 Insulin aspart A10AB06 Insulin glulisine A10AB30 Combinations === A10AC Insulins and analogues for injection, intermediate-acting === A10AC01 Insulin (human) A10AC02 Insulin (beef) A10AC03 Insulin (pork) A10AC04 Insulin lispro A10AC30 Combinations
AAA proteases use the energy from ATP hydrolysis to translocate a protein inside the proteasome for degradation. Cdc48p/p97 functions as a hexameric AAA+ ATPase that provides the mechanical force necessary for substrate dislocation. Its activity is tightly regulated by ATP binding and hydrolysis, which induce conformational changes required for protein unfolding and extraction. The HbYX motif plays a crucial role in regulating this process by mediating interactions between Cdc48p/p97 and downstream effectors such as the 20S proteasome or specific cofactors (e.g., Ufd1/Npl4). This interaction facilitates substrate transfer from Cdc48p/p97 to the proteasome, ensuring efficient protein degradation. Given its pivotal role in protein homeostasis, Cdc48p/p97 has been implicated in a wide range of cellular processes beyond ERAD, including autophagy, mitochondrial quality control, and DNA repair. The dysregulation of its function, particularly through mutations affecting the ATPase domain or HbYX-mediated interactions, has been linked to neurodegenerative diseases and cancer.
Sources: en.wikipedia.org
Karl Fischer titration is a standard method for measuring water content in solid and liquid samples. The result helps confirm the expected monohydrate stoichiometry. Loss-on-drying can also indicate moisture but may not distinguish water from other volatile substances.
Creatinine forms through irreversible cyclization and loss of water from creatine, and the rate increases with temperature, moisture, and pH changes. In dry solid form, the reaction is slow. In solution, degradation can become noticeable over time.
A specification typically lists assay range, water content, appearance, identification, and limits for heavy metals, residual solvents, and microbial counts. It may also include particle size distribution or bulk density for handling purposes. These parameters are distinct from any claimed performance effect.
Creatine monohydrate is the hydrated solid form of creatine, a nitrogen-containing compound involved in cellular energy metabolism. It consists of one creatine molecule associated with one water molecule in a crystal lattice.