This is a working overview of peptide, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2025-09-01 and is reviewed periodically as new material appears.
In the anterior pituitary, the term "acidophil" is used to describe two different types of cells which stain well with acidic dyes. Somatotrophs, which secrete growth hormone (a peptide hormone) Lactotrophs, which secrete prolactin (a peptide hormone) When using standard staining techniques, they cannot be distinguished from each other (though they can be distinguished from basophils and chromophobes), and are therefore identified simply as "acidophils". Eosinophilic Acidophile (histology) Basophilic Chromophobe cell Melanotroph Chromophil Basophil cell Oxyphil cell Oxyphil cell (parathyroid) Pituitary gland Neuroendocrine cell
Different 2A peptides have different peptide-bond-skipping efficiencies, with T2A and P2A being the most efficient and F2A the least efficient. Therefore, up to 50% of F2A-linked proteins can in fact be produced as a fusion protein, which might cause some unpredictable outcomes, including a gain of function. One study reported that 2A sites cause the ribosome to fall off approximately 60% of the time, and that, together with ribosome read-through of about 10% for P2A and T2A, this results in reducing expression of the downstream peptide chain by about 70%. However, the level of drop-off detected in this study varied widely depending on the exact construct used, with some constructs showing little evidence of drop-off; furthermore, within a tri-cistronic transcript it reported a higher level of ribosome drop-off after one 2A sequence than after two 2As combined, which is at odds with a linear model of translation. IRES Recombinant DNA
B cells can internalize antigen that binds to their B cell receptor and present it to helper T cells. Unlike T cells, B cells can recognize soluble antigen for which their B cell receptor is specific. They can then process the antigen and present peptides using MHC class II molecules. When a T helper cell with a TCR specific for that peptide binds, the B cell marker CD40 binds to CD40L on the T cell surface. When activated by a T cell, a B cell can undergo antibody isotype switching, affinity maturation, as well as formation of memory cells.
Sources: en.wikipedia.org
The Bergmann azlactone peptide synthesis is a classic organic synthesis process for the preparation of dipeptides. In the presence of a base, peptides are formed by aminolysis of N-carboxyanhydrides of amino acids with amino acid esters (1). This reaction can be looked at in further detail by Bailey. The resulting peptide is then protected by esters of benzylchroroformate in order to keep the amino groups intact (2). This mechanism serves as a source of protection for the amino group in the amino acid. The ester will block the amino group from binding with other molecules. The last step in this reaction is the cyclization of the N-haloacylamino acids with an acetanhydride. This will result in the expected azlactone (3). The reaction with a second amino acid allows for the ring to open, later forming an acylated unsaturated dipeptide. The reaction happens in a step-wise function which allows for the amino group to be protected and the azlactone to be produced. Catalytic hydrogenation and hydrolysis then take place in order to produce the dipeptide (4).
Corin converts the atrial natriuretic peptide (ANP) precursor, pro-ANP, to mature ANP, a cardiac hormone that regulates salt-water balance and blood pressure. In mice, corin deficiency prevents pro-ANP processing and causes salt-sensitive hypertension. Corin may also function as a pro-brain-type natriuretic peptide convertase. Corin-mediated ANP production in the pregnant uterus promotes spiral artery remodeling and trophoblast invasion. CORIN mutations have been reported in patients with preeclampsia. In mice, corin functions in the dermal papilla to regulate coat color in an Agouti-dependent pathway.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
This can be applied to find the best substrates for proteolytic enzymes. The substrate is displayed on the bacterial cell surface between an affinity ligand and the scaffold, and the kinetics of substrate proteolysis is measured using FACS. Bacterial display can be used to find peptides which bind to specific cells e.g. breast cancer cells or stem cells. Displayed proteins are fluorescently tagged with GFP, so binding interactions between peptides and target cells can be seen by flow cytometry. Control samples are required in order to measure fluorescence levels in the absence of displayed peptides. Samples are also required which don’t contain displayed peptides, but contain mammalian cells and bacterial cells (including the scaffold). Vaccine delivery is a very common application of bacterial surface display. There are two types of live bacterial vaccines that can be made:
Sources: en.wikipedia.org
Calcitonin gene-related peptide 2 (CGRP2), also called calcitonin related polypeptide beta, is a hormone that in humans is encoded by the CALCB gene (previously CALC2). Like the related hormone, calcitonin gene-related peptide 1 (CGRP1), this hormone induces vasodilation (relaxation of blood vessels) through the activation of the CGRP receptor. This form of calcitonin gene-related peptide is traditionally considered to be the primary form used in the enteric nervous system (nervous system in the gut). The gene that encodes CGRP1, CALCA, also encodes the blood-calcium-reducing hormone calcitonin, but despite its name, this protein is encoded by a distinct gene (CALCB). This hormone activates the CGRP receptor, which is a two protein (heterodimer) complex that is composed of RAMP1 and CALCRL.
Bacterial display (or bacteria display or bacterial surface display) is a protein engineering technique used for in vitro protein evolution. Libraries of polypeptides displayed on the surface of bacteria can be screened using flow cytometry or iterative selection procedures (biopanning). This protein engineering technique allows us to link the function of a protein with the gene that encodes it. Bacterial display can be used to find target proteins with desired properties and can be used to make affinity ligands which are cell-specific. This system can be used in many applications including the creation of novel vaccines, the identification of enzyme substrates and finding the affinity of a ligand for its target protein. Bacterial display is often coupled with magnetic-activated cell sorting (MACS) or fluorescence-activated cell sorting (FACS) techniques. Competing methods for protein evolution in vitro are phage display, ribosome display, yeast display, and mRNA display. Bacteriophage display is the most common type of display system used although bacterial display is becoming increasingly popular as technical challenges are overcome. Bacterial display combined with FACS also has the advantage that it is a real-time technique.
Amylin, or islet amyloid polypeptide (IAPP), is a 37-residue peptide hormone. It is co-secreted with insulin from the pancreatic β-cells in the ratio of approximately 100:1 (insulin:amylin). Amylin plays a role in glycemic regulation by slowing gastric emptying and promoting satiety, thereby preventing spikes in blood glucose levels after a meal. IAPP is processed from an 89-residue coding sequence. Proislet amyloid polypeptide (proIAPP, proamylin, proislet protein) is produced in the pancreatic beta cells (β-cells) as a 67 amino acid, 7404 Dalton pro-peptide and undergoes post-translational modifications including protease cleavage to produce amylin.
In the anterior pituitary, the term "acidophil" is used to describe two different types of cells which stain well with acidic dyes. Somatotrophs, which secrete growth hormone (a peptide hormone) Lactotrophs, which secrete prolactin (a peptide hormone) When using standard staining techniques, they cannot be distinguished from each other (though they can be distinguished from basophils and chromophobes), and are therefore identified simply as "acidophils". Eosinophilic Acidophile (histology) Basophilic Chromophobe cell Melanotroph Chromophil Basophil cell Oxyphil cell Oxyphil cell (parathyroid) Pituitary gland Neuroendocrine cell
Anti-citrullinated protein antibodies (ACPAs) are autoantibodies (antibodies to an individual's own proteins) that are directed against peptides and proteins that are citrullinated. They are present in the majority of patients with rheumatoid arthritis. Clinically, cyclic citrullinated peptides (CCP) are frequently used to detect these antibodies in patient serum or plasma (then referred to as anti–citrullinated peptide antibodies). During inflammation, arginine amino acid residues can be enzymatically converted into citrulline residues in proteins such as vimentin, by a process called citrullination. If their shapes are significantly altered, the proteins may be seen as antigens by the immune system, thereby generating an immune response. ACPAs have proved to be powerful biomarkers that allow the diagnosis of rheumatoid arthritis (RA) to be made at a very early stage. In July 2010, the 2010 ACR/EULAR Rheumatoid Arthritis Classification Criteria were introduced. These new classification criteria include ACPA testing, and overruled the "old" ACR criteria of 1987 and are adapted for early RA diagnosis.
Sources: en.wikipedia.org